DDC antibody

Catalog No. ABIN629869

This Rabbit Polyclonal antibody specifically detects DDC in WB and IHC. It exhibits reactivity toward Human, Mouse and Dog.

Quick Overview for DDC antibody (ABIN629869)

Target: DDC (Dopa Decarboxylase (Aromatic L-Amino Acid Decarboxylase) (DDC))

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DDC antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-DDC Antibody

Purification: Purified

Immunogen: DDC antibody was raised using a synthetic peptide corresponding to a region with amino acids EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFE

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DDC Blocking Peptide, (ABIN937797), is also available for use as a blocking control in assays to test for specificity of this DDC antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DDC

Target: DDC (Dopa Decarboxylase (Aromatic L-Amino Acid Decarboxylase) (DDC))

Alternative Name: DDC

Background: DDC catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine.

Molecular Weight: 53 kDa (MW of target protein)

Pathways: Dopaminergic Neurogenesis