BRK1 antibody (Middle Region)

Catalog No. ABIN629872

This Rabbit Polyclonal antibody specifically detects BRK1 in IHC and WB. It exhibits reactivity toward Human, Mouse, Rat, Dog and Zebrafish (Danio rerio).

Quick Overview for BRK1 antibody (Middle Region) (ABIN629872)

Target: BRK1 (BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit (BRK1))

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BRK1 antibody is un-conjugated

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Product Details anti-BRK1 Antibody

Binding Specificity: Middle Region

Specificity: C3 ORF10 antibody was raised against the middle region of C3 rf10

Purification: Purified

Immunogen: C3 ORF10 antibody was raised using the middle region of C3 rf10 corresponding to a region with amino acids YIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C3ORF10 Blocking Peptide, (ABIN936099), is also available for use as a blocking control in assays to test for specificity of this C3ORF10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BRK1

Target: BRK1 (BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit (BRK1))

Alternative Name: C3ORF10

Background: C3orf10 is involved in regulation of actin and microtubule organization. It is a part of a WAVE complex that activates the Arp2/3 complex.

Molecular Weight: 9 kDa (MW of target protein)

Pathways: RTK Signaling