Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

NONO antibody (C-Term)

This anti-NONO antibody is a Rabbit Polyclonal antibody detecting NONO in WB and IHC. Suitable for Human and Dog.
Catalog No. ABIN629889

Quick Overview for NONO antibody (C-Term) (ABIN629889)

Target

See all NONO Antibodies
NONO (Non-POU Domain Containing, Octamer-Binding (NONO))

Reactivity

  • 77
  • 38
  • 34
  • 15
  • 11
  • 6
  • 5
  • 5
  • 5
  • 3
  • 3
  • 1
Human, Dog

Host

  • 70
  • 6
  • 2
Rabbit

Clonality

  • 61
  • 17
Polyclonal

Conjugate

  • 43
  • 5
  • 3
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
This NONO antibody is un-conjugated

Application

  • 60
  • 36
  • 24
  • 20
  • 14
  • 14
  • 13
  • 11
  • 10
  • 5
  • 3
  • 2
  • 1
  • 1
Western Blotting (WB), Immunohistochemistry (IHC)
  • Binding Specificity

    • 15
    • 8
    • 8
    • 5
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    C-Term

    Specificity

    NONO antibody was raised against the C terminal of NONO

    Purification

    Purified

    Immunogen

    NONO antibody was raised using the C terminal of NONO corresponding to a region with amino acids DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY
  • Application Notes

    WB: 1.25 µg/mL, IHC: 4-8 µg/mL
    Optimal conditions should be determined by the investigator.

    Comment

    NONO Blocking Peptide, (ABIN937355), is also available for use as a blocking control in assays to test for specificity of this NONO antibody

    Restrictions

    For Research Use only
  • Format

    Lyophilized

    Reconstitution

    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NONO antibody in PBS

    Concentration

    Lot specific

    Buffer

    PBS

    Handling Advice

    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.

    Storage

    4 °C/-20 °C

    Storage Comment

    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target

    NONO (Non-POU Domain Containing, Octamer-Binding (NONO))

    Alternative Name

    NONO

    Background

    NONO is DNA- and RNA binding protein, involved in several nuclear processes. It binds the conventional octamer sequence in double stranded DNA. It also binds single-stranded DNA and RNA at a site independent of the duplex site. It is involved in pre-mRNA splicing and interacts with U5 snRNA. The SFPQ-NONO heteromer associated with MATR3 may play a role in nuclear retention of defective RNAs, be involved in DNA unwinding by modulating the function of topoisomerase I/TOP1 and be involved in DNA nonhomologous end joining (NHEJ) required for double-strand break repair and V(D)J recombination and may stabilize paired DNA ends. NONO binds to an enhancer element in long terminal repeats of endogenous intracisternal A particles (IAPs) and activates transcription.

    Molecular Weight

    52 kDa (MW of target protein)
You are here:
Chat with us!