NONO antibody (C-Term)

Catalog No. ABIN629889

Product Details anti-NONO Antibody

Target: NONO (Non-POU Domain Containing, Octamer-Binding (NONO))

Binding Specificity: C-Term

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NONO antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: NONO antibody was raised against the C terminal of NONO

Purification: Purified

Immunogen: NONO antibody was raised using the C terminal of NONO corresponding to a region with amino acids DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NONO Blocking Peptide, catalog no. 33R-1969, is also available for use as a blocking control in assays to test for specificity of this NONO antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NONO antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NONO

Target: NONO (Non-POU Domain Containing, Octamer-Binding (NONO))

Alternative Name: NONO (NONO Products)

Synonyms: NMT55 antibody, NRB54 antibody, P54 antibody, P54NRB antibody, nmt55 antibody, nrb54 antibody, p54nrb antibody, xp54nrb antibody, AA407051 antibody, AV149256 antibody, nonA antibody, non-POU domain containing octamer binding antibody, non-POU domain containing, octamer-binding antibody, non-POU domain containing, octamer binding L homeolog antibody, non-POU-domain-containing, octamer binding protein antibody, NONO antibody, Nono antibody, nono.L antibody

Background: NONO is DNA- and RNA binding protein, involved in several nuclear processes. It binds the conventional octamer sequence in double stranded DNA. It also binds single-stranded DNA and RNA at a site independent of the duplex site. It is involved in pre-mRNA splicing and interacts with U5 snRNA. The SFPQ-NONO heteromer associated with MATR3 may play a role in nuclear retention of defective RNAs, be involved in DNA unwinding by modulating the function of topoisomerase I/TOP1 and be involved in DNA nonhomologous end joining (NHEJ) required for double-strand break repair and V(D)J recombination and may stabilize paired DNA ends. NONO binds to an enhancer element in long terminal repeats of endogenous intracisternal A particles (IAPs) and activates transcription.

Molecular Weight: 52 kDa (MW of target protein)