RBMS3 antibody (C-Term)
Quick Overview for RBMS3 antibody (C-Term) (ABIN629891)
Target
See all RBMS3 AntibodiesReactivity
Host
Clonality
Conjugate
Application
-
-
Binding Specificity
- C-Term
-
Specificity
- RBMS3 antibody was raised against the C terminal of RBMS3
-
Purification
- Purified
-
Immunogen
- RBMS3 antibody was raised using the C terminal of RBMS3 corresponding to a region with amino acids TAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEHAPAYSYQQSKP
-
-
anti-RNA Binding Motif, Single Stranded Interacting Protein 3 (RBMS3) antibody
RBMS3 Reactivity: Human, Mouse ELISA, WB, IHC Host: Rabbit Polyclonal unconjugated
anti-RNA Binding Motif, Single Stranded Interacting Protein 3 (RBMS3) (AA 372-437) antibodyRBMS3 Reactivity: Human ELISA, IF Host: Rabbit Polyclonal unconjugated
anti-RNA Binding Motif, Single Stranded Interacting Protein 3 (RBMS3) (AA 334-433) antibodyRBMS3 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
anti-RNA Binding Motif, Single Stranded Interacting Protein 3 (RBMS3) (Internal Region) antibodyRBMS3 Reactivity: Human, Mouse ELISA, WB, IF, ICC Host: Rabbit Polyclonal unconjugated
anti-RNA Binding Motif, Single Stranded Interacting Protein 3 (RBMS3) (C-Term) antibodyRBMS3 Reactivity: Human, Dog, Guinea Pig, Rabbit, Monkey WB, IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-RNA Binding Motif, Single Stranded Interacting Protein 3 (RBMS3) (AA 125-174) antibodyRBMS3 Reactivity: Human, Mouse, Dog, Guinea Pig, Rabbit, Rat, Cow, Horse, Zebrafish (Danio rerio), Monkey, Goat, Bat, Pig, Chicken, Xenopus laevis WB Host: Rabbit Polyclonal unconjugated
anti-RNA Binding Motif, Single Stranded Interacting Protein 3 (RBMS3) (C-Term) antibodyRBMS3 Reactivity: Human, Mouse, Dog, Guinea Pig, Rabbit, Cow, Monkey WB Host: Rabbit Polyclonal unconjugated
anti-RNA Binding Motif, Single Stranded Interacting Protein 3 (RBMS3) (AA 311-421) antibodyRBMS3 Reactivity: Human ELISA, WB Host: Mouse Monoclonal 3B11 unconjugated
anti-RNA Binding Motif, Single Stranded Interacting Protein 3 (RBMS3) (C-Term) antibodyRBMS3 Reactivity: Human, Dog, Guinea Pig, Rabbit, Cow, Horse, Monkey, Bat, Pig WB Host: Rabbit Polyclonal unconjugated
anti-RNA Binding Motif, Single Stranded Interacting Protein 3 (RBMS3) (N-Term) antibodyRBMS3 Reactivity: Human, Mouse, Dog, Rat, Zebrafish (Danio rerio) WB Host: Rabbit Polyclonal unconjugated
-
-
Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. -
Comment
-
RBMS3 Blocking Peptide, (ABIN5615804), is also available for use as a blocking control in assays to test for specificity of this RBMS3 antibody
-
Restrictions
- For Research Use only
-
-
-
Format
- Lyophilized
-
Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBMS3 antibody in PBS
-
Concentration
- Lot specific
-
Buffer
- PBS
-
Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Storage
- 4 °C/-20 °C
-
Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- RBMS3 (RNA Binding Motif, Single Stranded Interacting Protein 3 (RBMS3))
-
Alternative Name
- RBMS3
-
Background
- RBMS3 is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis.
-
Molecular Weight
- 46 kDa (MW of target protein)
Target
-
