HNRNPL antibody (N-Term)

Catalog No. ABIN629902

Product Details anti-HNRNPL Antibody

Target: HNRNPL (Heterogeneous Nuclear Ribonucleoprotein L (HNRNPL))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HNRNPL antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: HNRPL antibody was raised against the N terminal of HNRPL

Purification: Purified

Immunogen: HNRPL antibody was raised using the N terminal of HNRPL corresponding to a region with amino acids DTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHD

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HNRPL Blocking Peptide, catalog no. 33R-2211, is also available for use as a blocking control in assays to test for specificity of this HNRPL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HNRNPL

Target: HNRNPL (Heterogeneous Nuclear Ribonucleoprotein L (HNRNPL))

Alternative Name: HNRPL (HNRNPL Products)

Synonyms: HNRPL antibody, hnRNP-L antibody, zgc:55429 antibody, HNRNPL antibody, hnrpl antibody, C79783 antibody, D830027H13Rik antibody, Hnrpl antibody, hnrnp-L antibody, heterogeneous nuclear ribonucleoprotein L antibody, HNRNPL antibody, hnrpl antibody, hnrnpl antibody, Hnrnpl antibody

Background: Heterogeneous nuclear RNAs (hnRNAs) which include mRNA precursors and mature mRNAs are associated with specific proteins to form heterogenous ribonucleoprotein (hnRNP) complexes. Heterogeneous nuclear ribonucleoprotein L is among the proteins that are stably associated with hnRNP complexes and along with other hnRNP proteins is likely to play a major role in the formation, packaging, processing, and function of mRNA.

Molecular Weight: 65 kDa (MW of target protein)