ISG20 antibody (N-Term)
Quick Overview for ISG20 antibody (N-Term) (ABIN629913)
Target
See all ISG20 AntibodiesReactivity
Host
Clonality
Conjugate
Application
-
-
Binding Specificity
- N-Term
-
Specificity
- ISG20 antibody was raised against the N terminal of ISG20
-
Purification
- Purified
-
Immunogen
- ISG20 antibody was raised using the N terminal of ISG20 corresponding to a region with amino acids GAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPFAVARLEILQLLKGK
-
-
-
-
Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. -
Comment
-
ISG20 Blocking Peptide, (ABIN938565), is also available for use as a blocking control in assays to test for specificity of this ISG20 antibody
-
Restrictions
- For Research Use only
-
-
-
Format
- Lyophilized
-
Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ISG20 antibody in PBS
-
Concentration
- Lot specific
-
Buffer
- PBS
-
Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Storage
- 4 °C/-20 °C
-
Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- ISG20 (Interferon Stimulated Exonuclease Gene 20kDa (ISG20))
-
Alternative Name
- ISG20
-
Background
- ISG20 belongs to the the exonuclease superfamily. It is exonuclease with specificity for single-stranded RNA and, to a lesser extent for DNA. It degrades RNA at a rate that is approximately 35-fold higher than its rate for single-stranded DNA. It is involved in the antiviral function of IFN against RNA viruses.
-
Molecular Weight
- 20 kDa (MW of target protein)
Target
-