ADAT1 antibody (C-Term)

Catalog No. ABIN629916

This anti-ADAT1 antibody is a Rabbit Polyclonal antibody detecting ADAT1 in WB and IHC. Suitable for Human, Mouse, Rat and Dog.

Quick Overview for ADAT1 antibody (C-Term) (ABIN629916)

Target: ADAT1 (Adenosine Deaminase, tRNA-Specific 1 (ADAT1))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADAT1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-ADAT1 Antibody

Binding Specificity: C-Term

Specificity: ADAT1 antibody was raised against the C terminal of ADAT1

Purification: Purified

Immunogen: ADAT1 antibody was raised using the C terminal of ADAT1 corresponding to a region with amino acids RLVPCGAAISWSAVPEQPLDVTANGFPQGTTKKTIGSLQARSQISKVELF

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ADAT1 Blocking Peptide, (ABIN5611943), is also available for use as a blocking control in assays to test for specificity of this ADAT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ADAT1

Target: ADAT1 (Adenosine Deaminase, tRNA-Specific 1 (ADAT1))

Alternative Name: ADAT1

Background: ADAT1 is a member of the ADAR (adenosine deaminase acting on RNA) family. Using site-specific adenosine modification, the family participates in the pre-mRNA editing of nuclear transcripts. ADAT1, tRNA-specific adenosine deaminase 1, is responsible for the deamination of adenosine 37 to inosine in eukaryotic tRNA.

Molecular Weight: 39 kDa (MW of target protein)