PGBD3 antibody (N-Term)

Catalog No. ABIN629938

Product Details anti-PGBD3 Antibody

Target: PGBD3 (PiggyBac Transposable Element Derived 3 (PGBD3))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PGBD3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PGBD3 antibody was raised against the N terminal of PGBD3

Purification: Purified

Immunogen: PGBD3 antibody was raised using the N terminal of PGBD3 corresponding to a region with amino acids NLPGSLLHTAAYLIQDGSDAESDSDDPSYAPKDDSPDEVPSTFTVQQPPP

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PGBD3 Blocking Peptide, catalog no. 33R-6766, is also available for use as a blocking control in assays to test for specificity of this PGBD3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGBD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PGBD3

Target: PGBD3 (PiggyBac Transposable Element Derived 3 (PGBD3))

Alternative Name: PGBD3 (PGBD3 Products)

Synonyms: PGBD3 antibody, piggyBac transposable element derived 3 antibody, ERCC excision repair 6, chromatin remodeling factor antibody, PGBD3 antibody, ERCC6 antibody

Background: The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. Anti-PGBD3 belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. Anti-PGBD3 overlaps with the ERCC6 gene on chromosome 10, and pseudogenes of this locus have been found on chromosomes 4, 5 and 12.

Molecular Weight: 65 kDa (MW of target protein)

Pathways: Chromatin Binding