DDX23 antibody

Catalog No. ABIN629956

Product Details anti-DDX23 Antibody

Target: DDX23 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 23 (DDX23))

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DDX23 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: DDX23 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDSAVFYELKQAILESPVSSCPPELANHPDAQHKPGTILTKKRREETIFA

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DDX23 Blocking Peptide, catalog no. 33R-2328, is also available for use as a blocking control in assays to test for specificity of this DDX23 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX23 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DDX23

Target: DDX23 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 23 (DDX23))

Alternative Name: DDX23 (DDX23 Products)

Synonyms: PRPF28 antibody, SNRNP100 antibody, U5-100K antibody, U5-100KD antibody, prp28 antibody, wu:fi39b12 antibody, zgc:63742 antibody, 3110082M05Rik antibody, 4921506D17Rik antibody, DEAD-box helicase 23 antibody, U5 snRNP 100 kD protein antibody, DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 antibody, DDX23 antibody, cgd3_3690 antibody, Chro.30417 antibody, PY04051 antibody, ddx23 antibody, Ddx23 antibody

Background: DDX23 encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.

Molecular Weight: 90 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization