RPS14 antibody (N-Term)
-
- Target See all RPS14 Antibodies
- RPS14 (Ribosomal Protein S14 (RPS14))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, Zebrafish (Danio rerio), Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RPS14 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RPS14 antibody was raised against the N terminal of RPS14
- Purification
- Purified
- Immunogen
- RPS14 antibody was raised using the N terminal of RPS14 corresponding to a region with amino acids APRKGKEKKEEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVTDLSGKE
- Top Product
- Discover our top product RPS14 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RPS14 Blocking Peptide, catalog no. 33R-1437, is also available for use as a blocking control in assays to test for specificity of this RPS14 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS14 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RPS14 (Ribosomal Protein S14 (RPS14))
- Alternative Name
- RPS14 (RPS14 Products)
- Synonyms
- EMTB antibody, S14 antibody, 2600014J02Rik antibody, AL023078 antibody, fa92e08 antibody, wu:fa92e08 antibody, zgc:73215 antibody, CG1527 antibody, Dmel\CG1527 antibody, RPS14B antibody, RpS14 antibody, RpS14B antibody, S14b antibody, anon-EST:Posey115 antibody, anon-EST:Posey131 antibody, anon-EST:Posey154 antibody, anon-EST:Posey77 antibody, rpS14B antibody, ribosomal protein S14 antibody, 40S ribosomal protein S14 antibody, ribosomal protein S14 L homeolog antibody, 30S ribosomal protein S14 antibody, Ribosomal protein S14b antibody, mitochondrial ribosomal protein S14 antibody, RPS14 antibody, Rps14 antibody, rps-14 antibody, rps14 antibody, rps14.L antibody, LOC100286294 antibody, RpS14 antibody, RpS14b antibody, MRPS14 antibody
- Background
- Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPS14 is a component of the 40S subunit. The protein belongs to the S11P family of ribosomal proteins. It is located in the cytoplasm. Transcript variants utilizing alternative transcription initiation sites have been described in the literature.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.
- Molecular Weight
- 17 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly
-