CELF2 antibody (N-Term)

Catalog No. ABIN629968

This Rabbit Polyclonal antibody specifically detects CELF2 in WB and IHC. It exhibits reactivity toward Human, Mouse, Rat, Zebrafish (Danio rerio) and Dog.

Quick Overview for CELF2 antibody (N-Term) (ABIN629968)

Target: CELF2 (CUGBP, Elav-Like Family Member 2 (CELF2))

Reactivity: Human, Mouse, Rat, Zebrafish (Danio rerio), Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CELF2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-CELF2 Antibody

Binding Specificity: N-Term

Specificity: CUGBP2 antibody was raised against the N terminal of CUGBP2

Purification: Purified

Immunogen: CUGBP2 antibody was raised using the N terminal of CUGBP2 corresponding to a region with amino acids VYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHP

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CUGBP2 Blocking Peptide, (ABIN5613034), is also available for use as a blocking control in assays to test for specificity of this CUGBP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CUGBP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CELF2

Target: CELF2 (CUGBP, Elav-Like Family Member 2 (CELF2))

Alternative Name: CUGBP2

Background: Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation.

Molecular Weight: 56 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization