DDX1 antibody

Catalog No. ABIN629970

The Rabbit Polyclonal anti-DDX1 antibody (ABIN629970) specifically detects DDX1 in WB. The antibody is reactive with Human, Mouse, Rat and Dog samples.

Quick Overview for DDX1 antibody (ABIN629970)

Target: DDX1 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 1 (DDX1))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DDX1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DDX1 Antibody

Purification: Purified

Immunogen: DDX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQVEPDIKVPVDEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQELAALEK

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DDX1 Blocking Peptide, (ABIN5613154), is also available for use as a blocking control in assays to test for specificity of this DDX1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DDX1

Target: DDX1 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 1 (DDX1))

Alternative Name: DDX1

Background: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein of unknown function. It shows high transcription levels in 2 retinoblastoma cell lines and in tissues of neuroectodermal origin.

Molecular Weight: 81 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization