DDX6 antibody

Catalog No. ABIN629973

Product Details anti-DDX6 Antibody

Target: DDX6 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 6 (DDX6))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DDX6 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: DDX6 antibody was raised using a synthetic peptide corresponding to a region with amino acids KTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQ

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DDX6 Blocking Peptide, catalog no. 33R-4684, is also available for use as a blocking control in assays to test for specificity of this DDX6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DDX6

Target: DDX6 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 6 (DDX6))

Alternative Name: DDX6 (DDX6 Products)

Synonyms: si:ch211-147p17.1 antibody, P54H antibody, Xp54 antibody, hlr2 antibody, me31b antibody, p54 antibody, rck antibody, HLR2 antibody, P54 antibody, RCK antibody, p54h antibody, RGD1564560 antibody, 1110001P04Rik antibody, E230023J21Rik antibody, mRCK/P54 antibody, DEAD-box helicase 6 antibody, DEAD (Asp-Glu-Ala-Asp) box helicase 6 antibody, DEAD-box helicase 6 L homeolog antibody, DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 antibody, DDX6 antibody, ddx6 antibody, ddx6.L antibody, Ddx6 antibody

Background: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX6 encodes a DEAD box protein. It may contribute to the cell proliferation and carcinogenesis.

Molecular Weight: 52 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization