Cytokeratin 18 antibody (C-Term)

Catalog No. ABIN629978

Product Details anti-Cytokeratin 18 Antibody

Target: Cytokeratin 18 (KRT18) (Keratin 18 (KRT18))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Cytokeratin 18 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: Cytokeratin 18 antibody was raised against the C terminal of KRT18

Purification: Purified

Immunogen: Cytokeratin 18 antibody was raised using the C terminal of KRT18 corresponding to a region with amino acids ALLNIKVKLEAEIATYRRLLEDGEDFNLGDALDSSNSMQTIQKTTTRRIV

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Cytokeratin 18 Blocking Peptide, catalog no. 33R-1352, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 18 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Cytokeratin 18

Target: Cytokeratin 18 (KRT18) (Keratin 18 (KRT18))

Alternative Name: Cytokeratin 18 (KRT18 Products)

Background: KRT18 (Keratin 18) is type I intermediate filament chain. Keratin 18, together with its filament partner keratin 8, are perhaps the most commonly found members of the intermediate filament gene family. They are expressed in single layer epithelial tissues of the body. Mutations in this gene have been linked to cryptogenic cirrhosis.

Molecular Weight: 47 kDa (MW of target protein)

Pathways: Apoptosis, Caspase Cascade in Apoptosis