CPNE1 antibody (N-Term)

Catalog No. ABIN629980

Product Details anti-CPNE1 Antibody

Target: CPNE1 (Copine I (CPNE1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CPNE1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: Copine I antibody was raised against the N terminal of CPNE1

Purification: Purified

Immunogen: Copine I antibody was raised using the N terminal of CPNE1 corresponding to a region with amino acids TVQKLRFGIYDIDNKTPELRDDDFLGGAECSLGQIVSSQVLTLPLMLKPG

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Copine I Blocking Peptide, catalog no. 33R-9369, is also available for use as a blocking control in assays to test for specificity of this Copine I antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPNE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CPNE1

Target: CPNE1 (Copine I (CPNE1))

Alternative Name: Copine I (CPNE1 Products)

Synonyms: CPNE1 antibody, MGC108079 antibody, COPN1 antibody, CPN1 antibody, 1810028N16Rik antibody, mKIAA4108 antibody, cpne3 antibody, cpne3l antibody, wu:fb69d07 antibody, wu:fc45a04 antibody, zgc:55873 antibody, copine I antibody, copine 1 antibody, RNA-binding protein 12 antibody, copine-1 antibody, copine I L homeolog antibody, CPNE1 antibody, cpne1 antibody, CPNE1b antibody, LOC100032499 antibody, LOC100484845 antibody, EDI_033120 antibody, LOC100281056 antibody, cpne1.L antibody, Cpne1 antibody

Background: Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. CPNE1 is a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking.

Molecular Weight: 59 kDa (MW of target protein)