SF3B4 antibody (N-Term)

Catalog No. ABIN629981

The Rabbit Polyclonal anti-SF3B4 antibody has been validated for WB and IHC. It is suitable to detect SF3B4 in samples from Human, Mouse, Rat, Dog and Zebrafish (Danio rerio).

Quick Overview for SF3B4 antibody (N-Term) (ABIN629981)

Target: SF3B4 (Splicing Factor 3b, Subunit 4, 49kDa (SF3B4))

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SF3B4 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-SF3B4 Antibody

Binding Specificity: N-Term

Specificity: SF3 B4 antibody was raised against the N terminal of SF3 4

Purification: Purified

Immunogen: SF3 B4 antibody was raised using the N terminal of SF3 4 corresponding to a region with amino acids QDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVE

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SF3B4 Blocking Peptide, (ABIN5616091), is also available for use as a blocking control in assays to test for specificity of this SF3B4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF0 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SF3B4

Target: SF3B4 (Splicing Factor 3b, Subunit 4, 49kDa (SF3B4))

Alternative Name: SF3B4

Background: SF3B4 is one of four subunits of the splicing factor 3B. The protein cross-links to a region in the pre-mRNA immediately upstream of the branchpoint sequence in pre-mRNA in the prespliceosomal complex A. It also may be involved in the assembly of the B, C and E spliceosomal complexes. In addition to RNA-binding activity, this protein interacts directly and highly specifically with subunit 2 of the splicing factor 3B. This protein contains two N-terminal RNA-recognition motifs (RRMs), consistent with the observation that it binds directly to pre-mRNA.

Molecular Weight: 47 kDa (MW of target protein)