NIP7 antibody

Catalog No. ABIN629985

The Rabbit Polyclonal anti-NIP7 antibody (ABIN629985) specifically detects NIP7 in WB and IHC. The antibody is reactive with Human, Mouse and Dog samples.

Quick Overview for NIP7 antibody (ABIN629985)

Target: NIP7 (Nuclear Import 7 Homolog (NIP7))

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NIP7 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-NIP7 Antibody

Purification: Purified

Immunogen: NIP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NIP7 Blocking Peptide, (ABIN5614996), is also available for use as a blocking control in assays to test for specificity of this NIP7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NIP7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NIP7

Target: NIP7 (Nuclear Import 7 Homolog (NIP7))

Alternative Name: NIP7

Background: NIP7 contains 1PUA domain and belongs to the NIP7 family. It may play a role in 60S ribosomal subunit synthesis.

Molecular Weight: 20 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly