SFPQ antibody

Catalog No. ABIN629995

This Rabbit Polyclonal antibody specifically detects SFPQ in WB and IHC. It exhibits reactivity toward Human.

Quick Overview for SFPQ antibody (ABIN629995)

Target: SFPQ (Splicing Factor Proline/glutamine-Ric (SFPQ))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SFPQ antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-SFPQ Antibody

Purification: Purified

Immunogen: SFPQ antibody was raised using a synthetic peptide corresponding to a region with amino acids VPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGLSTPGGHPKPPHRGGGE

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SFPQ Blocking Peptide, (ABIN5616098), is also available for use as a blocking control in assays to test for specificity of this SFPQ antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFPQ antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SFPQ

Target: SFPQ (Splicing Factor Proline/glutamine-Ric (SFPQ))

Alternative Name: SFPQ

Background: SFPQ is DNA- and RNA binding protein. It is essential pre-mRNA splicing factor required early in spliceosome formation and for splicing catalytic step II, probably as an heteromer with NONO. It binds to pre-mRNA in spliceosome C complex, and specifically binds to intronic polypyrimidine tracts. It interacts with U5 snRNA. It may be involved in a pre-mRNA coupled splicing and polyadenylation process as component of a snRNP-free complex with SNRPA/U1A.

Molecular Weight: 78 kDa (MW of target protein)