RBPMS antibody (N-Term)

Catalog No. ABIN630003

This anti-RBPMS antibody is a Rabbit Polyclonal antibody detecting RBPMS in WB and IHC. Suitable for Human, Rat, Mouse and Dog.

Quick Overview for RBPMS antibody (N-Term) (ABIN630003)

Target: RBPMS (RNA Binding Protein with Multiple Splicing (RBPMS))

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RBPMS antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-RBPMS Antibody

Binding Specificity: N-Term

Specificity: RBPMS antibody was raised against the N terminal of RBPMS

Purification: Purified

Immunogen: RBPMS antibody was raised using the N terminal of RBPMS corresponding to a region with amino acids LFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGIRFDPEIPQ

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBPMS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RBPMS

Target: RBPMS (RNA Binding Protein with Multiple Splicing (RBPMS))

Alternative Name: RBPMS

Background: RBPMS is a member of the RRM family of RNA-binding proteins. The RRM domain is between 80-100 amino acids in length and family members contain one to four copies of the domain. The RRM domain consists of two short stretches of conserved sequence called RNP1 and RNP2, as well as a few highly conserved hydrophobic residues. RBPMS has a single, putative RRM domain in its N-terminus.

Molecular Weight: 24 kDa (MW of target protein)