LARP7 antibody (C-Term)

Catalog No. ABIN630024

This anti-LARP7 antibody is a Rabbit Polyclonal antibody detecting LARP7 in WB. Suitable for Human, Mouse, Rat and Dog.

Quick Overview for LARP7 antibody (C-Term) (ABIN630024)

Target: LARP7 (La Ribonucleoprotein Domain Family, Member 7 (LARP7))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LARP7 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LARP7 Antibody

Binding Specificity: C-Term

Specificity: LARP7 antibody was raised against the C terminal of LARP7

Purification: Purified

Immunogen: LARP7 antibody was raised using the C terminal of LARP7 corresponding to a region with amino acids HCWKLEILSGDHEQRYWQKILVDRQAKLNQPREKKRGTEKLITKAEKIRL

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LARP7 Blocking Peptide, (ABIN939089), is also available for use as a blocking control in assays to test for specificity of this LARP7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LARP7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LARP7

Target: LARP7 (La Ribonucleoprotein Domain Family, Member 7 (LARP7))

Alternative Name: LARP7

Background: LARP7 is a negative transcriptional regulator of polymerase II genes, acting by means of the 7SK RNP system. Within the 7SK RNP complex, the positive transcription elongation factor b (P-TEFb) is sequestered in an inactive form, preventing RNA polymerase II phosphorylation and subsequent transcriptional elongation.

Molecular Weight: 39 kDa (MW of target protein)

Pathways: Chromatin Binding, SARS-CoV-2 Protein Interactome, The Global Phosphorylation Landscape of SARS-CoV-2 Infection