HNRNPA3 antibody (N-Term)

Catalog No. ABIN630036

This anti-HNRNPA3 antibody is a Rabbit Polyclonal antibody detecting HNRNPA3 in WB and IHC. Suitable for Human, Mouse, Rat and Dog.

Quick Overview for HNRNPA3 antibody (N-Term) (ABIN630036)

Target: HNRNPA3 (Heterogeneous Nuclear Ribonucleoprotein A3 (HNRNPA3))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HNRNPA3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-HNRNPA3 Antibody

Binding Specificity: N-Term

Specificity: HNRPA3 antibody was raised against the N terminal of HNRPA3

Purification: Purified

Immunogen: HNRPA3 antibody was raised using the N terminal of HNRPA3 corresponding to a region with amino acids MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDS

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HNRPA3 Blocking Peptide, (ABIN5614043), is also available for use as a blocking control in assays to test for specificity of this HNRPA3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPA3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HNRNPA3

Target: HNRNPA3 (Heterogeneous Nuclear Ribonucleoprotein A3 (HNRNPA3))

Alternative Name: HNRPA3

Background: HNRPA3 plays a role in cytoplasmic trafficking of RNA. It binds to the cis-acting response element(A2RE) and may be involved in pre-mRNA splicing

Molecular Weight: 42 kDa (MW of target protein)