RPL32 antibody (N-Term)

Catalog No. ABIN630044

The Rabbit Polyclonal anti-RPL32 antibody has been validated for WB. It is suitable to detect RPL32 in samples from Human, Mouse, Rat and Dog.

Quick Overview for RPL32 antibody (N-Term) (ABIN630044)

Target: RPL32 (Ribosomal Protein L32 (RPL32))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPL32 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RPL32 Antibody

Binding Specificity: N-Term

Specificity: RPL32 antibody was raised against the N terminal of RPL32

Purification: Purified

Immunogen: RPL32 antibody was raised using the N terminal of RPL32 corresponding to a region with amino acids AALRPLVKPKIVKKRTKKFIRHQSDRYVKIKRNWRKPRGIDNRVRRRFKG

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPL32 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this RPL32 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL32 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPL32

Target: RPL32 (Ribosomal Protein L32 (RPL32))

Alternative Name: RPL32

Background: RPL32 is a ribosomal protein that is a component of the 60S subunit. RPL32 belongs to the L32E family of ribosomal proteins. It is located in the cytoplasm. Although some studies have mapped this gene to 3q13.3-q21, it is believed to map to 3p25-p24. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Molecular Weight: 15 kDa (MW of target protein)