CLCN3 antibody (C-Term)

Catalog No. ABIN630057

This anti-CLCN3 antibody is a Rabbit Polyclonal antibody detecting CLCN3 in WB and IHC. Suitable for Human.

Quick Overview for CLCN3 antibody (C-Term) (ABIN630057)

Target: CLCN3 (Chloride Channel 3 (CLCN3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CLCN3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-CLCN3 Antibody

Binding Specificity: C-Term

Specificity: CLCN3 antibody was raised against the C terminal of CLCN3

Purification: Purified

Immunogen: CLCN3 antibody was raised using the C terminal of CLCN3 corresponding to a region with amino acids MESEQLFHRGYYRNSYNSITSASSDEELLDGAGVIMDFQTSEDDNLLDGD

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CLCN3 Blocking Peptide, (ABIN5612915), is also available for use as a blocking control in assays to test for specificity of this CLCN3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLCN3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CLCN3

Target: CLCN3 (Chloride Channel 3 (CLCN3))

Alternative Name: CLCN3

Background: CLCN3 plays an important role in the cell proliferation of vascular smooth muscle cells. The PDZ-binding isoform of CLCN3 resides in the Golgi where it co-localizes with a small amount of CFTR (cystic fibrosis transmembrane conductance regulator).

Molecular Weight: 95 kDa (MW of target protein)