KCNAB3 antibody (N-Term)

Catalog No. ABIN630058

Product Details anti-KCNAB3 Antibody

Target: KCNAB3 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 3 (KCNAB3))

Binding Specificity: N-Term

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNAB3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: KCNAB3 antibody was raised against the N terminal of KCNAB3

Purification: Purified

Immunogen: KCNAB3 antibody was raised using the N terminal of KCNAB3 corresponding to a region with amino acids RNLGKSGLRVSCLGLGTWVTFGSQISDETAEDVLTVAYEHGVNLFDTAEV

Application Details

Application Notes: WB: 0.65 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNAB3 Blocking Peptide, catalog no. 33R-8079, is also available for use as a blocking control in assays to test for specificity of this KCNAB3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNAB3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCNAB3

Target: KCNAB3 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 3 (KCNAB3))

Alternative Name: KCNAB3 (KCNAB3 Products)

Background: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s).

Molecular Weight: 44 kDa (MW of target protein)