CLIC1 antibody (C-Term)

Catalog No. ABIN630062

The Rabbit Polyclonal anti-CLIC1 antibody has been validated for WB. It is suitable to detect CLIC1 in samples from Human, Rat and Mouse.

Quick Overview for CLIC1 antibody (C-Term) (ABIN630062)

Target: CLIC1 (Chloride Intracellular Channel 1 (CLIC1))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CLIC1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CLIC1 Antibody

Binding Specificity: C-Term

Specificity: CLIC1 antibody was raised against the C terminal of CLIC1

Purification: Purified

Immunogen: CLIC1 antibody was raised using the C terminal of CLIC1 corresponding to a region with amino acids LTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFAST

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CLIC1 Blocking Peptide, catalog no. 33R-5478, is also available for use as a blocking control in assays to test for specificity of this CLIC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLIC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CLIC1

Target: CLIC1 (Chloride Intracellular Channel 1 (CLIC1))

Alternative Name: CLIC1

Background: Chloride intracellular channel 1 is a member of the p64 family, a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. CLIon Channel1 encodes a protein that localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity.

Molecular Weight: 27 kDa (MW of target protein)