KCTD6 antibody (N-Term)

Catalog No. ABIN630078

Product Details anti-KCTD6 Antibody

Target: KCTD6 (Potassium Channel Tetramerisation Domain Containing 6 (KCTD6))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCTD6 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: KCTD6 antibody was raised against the N terminal of KCTD6

Purification: Purified

Immunogen: KCTD6 antibody was raised using the N terminal of KCTD6 corresponding to a region with amino acids HLYTTSLTTLTRYPDSMLGAMFGGDFPTTRDPQGNYFINRDGPLFRYVLN

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCTD6 Blocking Peptide, catalog no. 33R-3794, is also available for use as a blocking control in assays to test for specificity of this KCTD6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCTD6

Target: KCTD6 (Potassium Channel Tetramerisation Domain Containing 6 (KCTD6))

Alternative Name: KCTD6 (KCTD6 Products)

Synonyms: KCTD6 antibody, 5430433B02Rik antibody, AU044285 antibody, kctd6 antibody, zgc:91884 antibody, KCASH3 antibody, potassium channel tetramerization domain containing 6 antibody, potassium channel tetramerisation domain containing 6 antibody, potassium channel tetramerization domain containing 6b antibody, KCTD6 antibody, kctd6 antibody, Kctd6 antibody, kctd6b antibody

Background: KCTD6 is a domain of potassium channel.

Molecular Weight: 28 kDa (MW of target protein)