KCNAB2 antibody (C-Term)
-
- Target See all KCNAB2 Antibodies
- KCNAB2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 2 (KCNAB2))
-
Binding Specificity
- C-Term
-
Reactivity
- Rat, Human, Mouse, Dog, Zebrafish (Danio rerio)
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KCNAB2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KCNAB2 antibody was raised against the C terminal of KCNAB2
- Purification
- Purified
- Immunogen
- KCNAB2 antibody was raised using the C terminal of KCNAB2 corresponding to a region with amino acids KYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTL
- Top Product
- Discover our top product KCNAB2 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KCNAB2 Blocking Peptide, catalog no. 33R-4735, is also available for use as a blocking control in assays to test for specificity of this KCNAB2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNAB2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNAB2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 2 (KCNAB2))
- Alternative Name
- KCNAB2 (KCNAB2 Products)
- Background
- This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member alters functional properties of the KCNA4 gene product.
- Molecular Weight
- 39 kDa (MW of target protein)
-