KCNAB2 antibody (Middle Region)
-
- Target See all KCNAB2 Antibodies
- KCNAB2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 2 (KCNAB2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Rat, Human, Mouse, Zebrafish (Danio rerio), Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KCNAB2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- KCNAB2 antibody was raised against the middle region of KCNAB2
- Purification
- Purified
- Immunogen
- KCNAB2 antibody was raised using the middle region of KCNAB2 corresponding to a region with amino acids WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV
- Top Product
- Discover our top product KCNAB2 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KCNAB2 Blocking Peptide, catalog no. 33R-9950, is also available for use as a blocking control in assays to test for specificity of this KCNAB2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNAB2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNAB2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 2 (KCNAB2))
- Alternative Name
- KCNAB2 (KCNAB2 Products)
- Synonyms
- kcnab2 antibody, KCNAB2 antibody, DKFZp459E056 antibody, akr6a5 antibody, kcna2b antibody, kvb-a antibody, kvb2 antibody, kvbeta2 antibody, kvbeta2.1 antibody, kvbeta2.2 antibody, AKR6A5 antibody, HKvbeta2 antibody, HKvbeta2.1 antibody, HKvbeta2.2 antibody, KCNA2B antibody, KV-BETA-2 antibody, Kvbeta2.1 antibody, F5 antibody, I2rf5 antibody, Kcnb3 antibody, kv-beta-2 antibody, potassium channel, voltage gated subfamily A regulatory beta subunit 1 antibody, potassium voltage-gated channel subfamily A regulatory beta subunit 2 antibody, potassium voltage-gated channel, shaker-related subfamily, beta member 2 a antibody, potassium channel, voltage gated subfamily A regulatory beta subunit 2 L homeolog antibody, voltage-gated potassium channel subunit beta-2 antibody, potassium voltage-gated channel, shaker-related subfamily, beta member 2 antibody, kcnab1 antibody, KCNAB2 antibody, kcnab2a antibody, kcnab2.L antibody, LOC397248 antibody, Kcnab2 antibody
- Background
- This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member alters functional properties of the KCNA4 gene product.Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume.
- Molecular Weight
- 40 kDa (MW of target protein)
-