NMUR2 antibody (N-Term)

Catalog No. ABIN630112

Product Details anti-NMUR2 Antibody

Target: NMUR2 (Neuromedin U Receptor 2 (NMUR2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NMUR2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NMUR2 antibody was raised against the N terminal of NMUR2

Purification: Purified

Immunogen: NMUR2 antibody was raised using the N terminal of NMUR2 corresponding to a region with amino acids MSGMEKLQNASWIYQQKLEDPFQKHLNSTEEYLAFLCGPRRSHFFLPVSV

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NMUR2 Blocking Peptide, catalog no. 33R-6432, is also available for use as a blocking control in assays to test for specificity of this NMUR2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NMUR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NMUR2

Target: NMUR2 (Neuromedin U Receptor 2 (NMUR2))

Alternative Name: NMUR2 (NMUR2 Products)

Synonyms: NMUR2 antibody, NMSR2 antibody, FM-4 antibody, FM4 antibody, NMU-R2 antibody, NMU2R antibody, TGR-1 antibody, TGR1 antibody, Nmu2r antibody, neuromedin U receptor 2 antibody, NMUR2 antibody, Nmur2 antibody

Background: NMUR2 encodes for one of two G-protein-coupled receptors for the neuropeptide, neuromedin U. This peptide is found in highest levels in the gut and genitourinary system where it potently contracts smooth muscle but is also expressed in the spinal cord and discrete regions of the brain. NMUR2 is highly expressed in the central nervous system.

Molecular Weight: 46 kDa (MW of target protein)

Pathways: Feeding Behaviour