FABP7 antibody (N-Term)

Catalog No. ABIN630122

Product Details anti-FABP7 Antibody

Target: FABP7 (Fatty Acid Binding Protein 7, Brain (FABP7))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FABP7 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FABP7 antibody was raised against the N terminal of FABP7

Purification: Purified

Immunogen: FABP7 antibody was raised using the N terminal of FABP7 corresponding to a region with amino acids NFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISF

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FABP7 Blocking Peptide, catalog no. 33R-6680, is also available for use as a blocking control in assays to test for specificity of this FABP7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FABP7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FABP7

Target: FABP7 (Fatty Acid Binding Protein 7, Brain (FABP7))

Alternative Name: FABP7 (FABP7 Products)

Synonyms: B-FABP antibody, FABP7 antibody, D168 antibody, fabp7 antibody, wu:fb62f07 antibody, wu:fq20b08 antibody, BLBP antibody, FABPB antibody, MRG antibody, BFABP antibody, Blbp antibody, fatty acid binding protein 7 antibody, fatty acid binding protein 7, brain, a antibody, fatty acid-binding protein, brain antibody, fatty acid binding protein 7, brain antibody, fatty acid binding protein 7, brain L homeolog antibody, fatty acid binding protein 7, brain, b antibody, FABP7 antibody, Fabp7 antibody, fabp7a antibody, fabp7 antibody, fabp7.L antibody, fabp7b antibody

Background: The protein encoded by FABP7 is a brain fatty acid binding protein. Fatty acid binding proteins (FABPs) are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs are thought to play roles in fatty acid uptake, transport, and metabolism.

Molecular Weight: 15 kDa (MW of target protein)