MBNL1 antibody

Catalog No. ABIN630124

This Rabbit Polyclonal antibody specifically detects MBNL1 in WB. It exhibits reactivity toward Human and Dog.

Quick Overview for MBNL1 antibody (ABIN630124)

Target: MBNL1 (Muscleblind-like Protein 1 (MBNL1))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MBNL1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MBNL1 Antibody

Purification: Purified

Immunogen: MBNL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LCPQQQHLPQVFPSLQQPQPTSPILDASTLLGATSCPAAAAGKMIPIISA

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MBNL1 Blocking Peptide, (ABIN940215), is also available for use as a blocking control in assays to test for specificity of this MBNL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBNL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MBNL1

Target: MBNL1 (Muscleblind-like Protein 1 (MBNL1))

Alternative Name: MBNL1

Background: MBNL1 contains 4 C3H1-type zinc fingers and binds to CUG triplet repeat expansion dsRNA.

Molecular Weight: 37 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization