FZD9 antibody

Catalog No. ABIN630125

Product Details anti-FZD9 Antibody

Target: FZD9 (Frizzled Family Receptor 9 (FZD9))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FZD9 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: FZD9 antibody was raised using a synthetic peptide corresponding to a region with amino acids RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FZD9 Blocking Peptide, catalog no. 33R-8100, is also available for use as a blocking control in assays to test for specificity of this FZD9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FZD9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FZD9

Target: FZD9 (Frizzled Family Receptor 9 (FZD9))

Alternative Name: FZD9 (FZD9 Products)

Synonyms: CD349 antibody, FZD3 antibody, mfz9 antibody, Fz-9 antibody, cFz-9 antibody, fz11 antibody, fzd9 antibody, fzx antibody, hm:zehl0603 antibody, zehl0603 antibody, zg11 antibody, frizzled class receptor 9 antibody, frizzled class receptor 9a antibody, frizzled class receptor 9b antibody, FZD9 antibody, Fzd9 antibody, fzd9a antibody, fzd9b antibody

Background: FZD9 contains 1 FZ (frizzled) domain and belongs to the G-protein coupled receptor Fz/Smo family. It is receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members. It may be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues.

Molecular Weight: 65 kDa (MW of target protein)

Pathways: WNT Signaling