MMP1 antibody

Catalog No. ABIN630128

The Rabbit Polyclonal anti-MMP1 antibody is suitable to detect MMP1 in samples from Human. It has been validated for WB and IHC.

Quick Overview for MMP1 antibody (ABIN630128)

Target: MMP1 (Matrix Metallopeptidase 1 (Interstitial Collagenase) (MMP1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MMP1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-MMP1 Antibody

Purification: Purified

Immunogen: MMP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEF

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MMP1 Blocking Peptide, (ABIN5614797), is also available for use as a blocking control in assays to test for specificity of this MMP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MMP1

Target: MMP1 (Matrix Metallopeptidase 1 (Interstitial Collagenase) (MMP1))

Alternative Name: MMP1

Background: Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP1 is a secreted enzyme which breaks down the interstitial collagens, types I, II, and III.

Molecular Weight: 52 kDa (MW of target protein)