GOT2 antibody

Catalog No. ABIN630134

The Rabbit Polyclonal anti-GOT2 antibody is suitable to detect GOT2 in samples from Human, Mouse, Rat, Zebrafish (Danio rerio) and Dog. It has been validated for WB.

Quick Overview for GOT2 antibody (ABIN630134)

Target: GOT2 (Glutamic-Oxaloacetic Transaminase 2, Mitochondrial (Aspartate Aminotransferase 2) (GOT2))

Reactivity: Human, Mouse, Rat, Zebrafish (Danio rerio), Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GOT2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GOT2 Antibody

Purification: Purified

Immunogen: GOT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAA

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GOT2 Blocking Peptide, (ABIN5613826), is also available for use as a blocking control in assays to test for specificity of this GOT2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GOT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GOT2

Target: GOT2 (Glutamic-Oxaloacetic Transaminase 2, Mitochondrial (Aspartate Aminotransferase 2) (GOT2))

Alternative Name: GOT2

Background: Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.

Molecular Weight: 45 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process