NAGS antibody (C-Term)

Catalog No. ABIN630135

Product Details anti-NAGS Antibody

Target: NAGS (N-Acetylglutamate Synthase (NAGS))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NAGS antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NAGS antibody was raised against the C terminal of NAGS

Purification: Purified

Immunogen: NAGS antibody was raised using the C terminal of NAGS corresponding to a region with amino acids YLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPWYFKHSD

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NAGS Blocking Peptide, catalog no. 33R-10162, is also available for use as a blocking control in assays to test for specificity of this NAGS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAGS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NAGS

Target: NAGS (N-Acetylglutamate Synthase (NAGS))

Alternative Name: NAGS (NAGS Products)

Synonyms: VF0585 antibody, AGAS antibody, ARGA antibody, 1700120E20Rik antibody, argA antibody, RGD1565783 antibody, N-acetylglutamate synthase antibody, amino-acid acetyltransferase ArgA antibody, argA antibody, ECs3675 antibody, VP2371 antibody, Psyr_0254 antibody, Sde_0360 antibody, NAGS antibody, Nags antibody

Background: NAGS is a mitochondrial enzyme that catalyzes the formation of N-acetylglutamate (NAG) from glutamate and acetyl coenzyme-A. NAG is a cofactor of carbamyl phosphate synthetase I (CPSI), the first enzyme of the urea cycle in mammals. Deficiencies in N-acetylglutamate synthase have been associated with hyperammonemia.

Molecular Weight: 58 kDa (MW of target protein)