NUCB2 antibody (Middle Region)
-
- Target See all NUCB2 Antibodies
- NUCB2 (Nucleobindin 2 (NUCB2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NUCB2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- Nucleobindin 2 antibody was raised against the middle region of NUCB2
- Purification
- Purified
- Immunogen
- Nucleobindin 2 antibody was raised using the middle region of NUCB2 corresponding to a region with amino acids MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE
- Top Product
- Discover our top product NUCB2 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Nucleobindin 2 Blocking Peptide, catalog no. 33R-6232, is also available for use as a blocking control in assays to test for specificity of this Nucleobindin 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUCB2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NUCB2 (Nucleobindin 2 (NUCB2))
- Alternative Name
- Nucleobindin 2 (NUCB2 Products)
- Synonyms
- nefa antibody, MGC97715 antibody, NUCB2 antibody, nucleobindin-2 antibody, NEFA antibody, AI607786 antibody, Calnuc antibody, Nefa antibody, Nesfatin-1 antibody, p54 antibody, nucleobindin 2 antibody, nucleobindin 2 L homeolog antibody, nucb2 antibody, NUCB2 antibody, Nucb2 antibody, nucb2.L antibody
- Background
- Nucleobindin-2 is a calcium-binding EF-hand protein.
- Molecular Weight
- 46 kDa (MW of target protein)
-