PSG5 antibody (N-Term)

Catalog No. ABIN630155

Product Details anti-PSG5 Antibody

Target: PSG5 (Pregnancy Specific beta-1-Glycoprotein 5 (PSG5))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PSG5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PSG5 antibody was raised against the N terminal of PSG5

Purification: Purified

Immunogen: PSG5 antibody was raised using the N terminal of PSG5 corresponding to a region with amino acids QLMDLYHYITSYVVDGQINIYGPAYTGRETVYSNASLLIQNVTREDAGSY

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PSG5 Blocking Peptide, catalog no. 33R-7634, is also available for use as a blocking control in assays to test for specificity of this PSG5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSG5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PSG5

Target: PSG5 (Pregnancy Specific beta-1-Glycoprotein 5 (PSG5))

Alternative Name: PSG5 (PSG5 Products)

Background: The pregnancy-specific beta 1 glycoprotein (PSG) is a group of heterogeneous proteins produced in large amounts by the human syncytiotrophoblast. They belong to the carcinoembryonic antigen (CEA) family. The function of PSG5 remains unknown.

Molecular Weight: 37 kDa (MW of target protein)