GZMH antibody

Catalog No. ABIN630169

This Rabbit Polyclonal antibody specifically detects GZMH in WB and IHC. It exhibits reactivity toward Human.

Quick Overview for GZMH antibody (ABIN630169)

Target: GZMH (Granzyme H (Cathepsin G-Like 2, Protein H-CCPX) (GZMH))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GZMH antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-GZMH Antibody

Purification: Purified

Immunogen: Granzyme H antibody was raised using a synthetic peptide corresponding to a region with amino acids MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCG

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Granzyme H Blocking Peptide, (ABIN5613855), is also available for use as a blocking control in assays to test for specificity of this Granzyme H antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GZMH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GZMH

Target: GZMH (Granzyme H (Cathepsin G-Like 2, Protein H-CCPX) (GZMH))

Alternative Name: Granzyme H

Background: This enzyme is probably necessary for target cell lysis in cell-mediated immune responses.

Molecular Weight: 27 kDa (MW of target protein)