FEN1 antibody (C-Term)

Catalog No. ABIN630178

This Rabbit Polyclonal antibody specifically detects FEN1 in WB. It exhibits reactivity toward Human, Mouse, Rat and Dog.

Quick Overview for FEN1 antibody (C-Term) (ABIN630178)

Target: FEN1 (Flap Structure-Specific Endonuclease 1 (FEN1))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FEN1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FEN1 Antibody

Binding Specificity: C-Term

Specificity: FEN1 antibody was raised against the C terminal of FEN1

Purification: Purified

Immunogen: FEN1 antibody was raised using the C terminal of FEN1 corresponding to a region with amino acids PNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSL

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FEN1 Blocking Peptide, (ABIN5613568), is also available for use as a blocking control in assays to test for specificity of this FEN1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FEN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FEN1

Target: FEN1 (Flap Structure-Specific Endonuclease 1 (FEN1))

Alternative Name: FEN1

Background: FEN1 removes 5' overhanging flaps in DNA repair and processes the 5' ends of Okazaki fragments in lagging strand DNA synthesis. Direct physical interaction between this protein and AP endonuclease 1 during long-patch base excision repair provides coordinated loading of the proteins onto the substrate, thus passing the substrate from one enzyme to another. The protein is a member of the XPG/RAD2 endonuclease family and is one of ten proteins essential for cell-free DNA replication. DNA secondary structure can inhibit flap processing at certain trinucleotide repeats in a length-dependent manner by concealing the 5' end of the flap that is necessary for both binding and cleavage by the protein encoded by this gene. Therefore, secondary structure can deter the protective function of this protein, leading to site-specific trinucleotide expansions.

Molecular Weight: 42 kDa (MW of target protein)

Pathways: Telomere Maintenance, DNA Damage Repair, DNA Replication, Synthesis of DNA