KIF1C antibody (C-Term)

Catalog No. ABIN630184

Product Details anti-KIF1C Antibody

Target: KIF1C (Kinesin Family Member 1C (KIF1C))

Binding Specificity: C-Term

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KIF1C antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KIF1 C antibody was raised against the C terminal of KIF1

Purification: Purified

Immunogen: KIF1 C antibody was raised using the C terminal of KIF1 corresponding to a region with amino acids GGGRSRGAGSAQPEPQHFQPKKHNSYPQPPQPYPAQRPPGPRYPPYTTPP

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KIF1C Blocking Peptide, catalog no. 33R-3283, is also available for use as a blocking control in assays to test for specificity of this KIF1C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KIF1C

Target: KIF1C (Kinesin Family Member 1C (KIF1C))

Alternative Name: KIF1C (KIF1C Products)

Synonyms: KIF1C antibody, ltxs1 antibody, DKFZp468E0822 antibody, LTXS1 antibody, B430105J22Rik antibody, D11Bwg1349e antibody, Ltxs1 antibody, kinesin family member 1C antibody, KIF1C antibody, kif1c antibody, Kif1c antibody

Background: KIF1C represents a member of the Unc104 subfamily of kinesin-like proteins that are involved in the transport of mitochondria or synaptic vesicles in axons. KIF1C consists of an amino-terminal motor domain followed by a U104 domain and probably binds to target membranes through carboxyl-terminal sequences.

Molecular Weight: 123 kDa (MW of target protein)