KIF25 antibody (C-Term)

Catalog No. ABIN630188

The Rabbit Polyclonal anti-KIF25 antibody has been validated for WB and IHC. It is suitable to detect KIF25 in samples from Human.

Quick Overview for KIF25 antibody (C-Term) (ABIN630188)

Target: KIF25 (Kinesin Family Member 25 (KIF25))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KIF25 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-KIF25 Antibody

Binding Specificity: C-Term

Specificity: KIF25 antibody was raised against the C terminal of KIF25

Purification: Purified

Immunogen: KIF25 antibody was raised using the C terminal of KIF25 corresponding to a region with amino acids VLGALLEHRGHAPYRNSRLTHLLQDCLGGDAKLLVILCISPSQRHLAQTL

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KIF25 Blocking Peptide, (ABIN5614351), is also available for use as a blocking control in assays to test for specificity of this KIF25 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF25 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KIF25

Target: KIF25 (Kinesin Family Member 25 (KIF25))

Alternative Name: KIF25

Background: The protein encoded by the KIF25 gene is a member of the kinesin-like protein family. Protein family members are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. However, the particular function of this gene product has not yet been determined. Two alternatively spliced transcript variants which encode products have been described. Other splice variants have been found that lack exon 2 and the initiation codon for translation.

Molecular Weight: 41 kDa (MW of target protein)