LIG4 antibody (N-Term)

Catalog No. ABIN630196

This Rabbit Polyclonal antibody specifically detects LIG4 in WB and IHC. It exhibits reactivity toward Human.

Quick Overview for LIG4 antibody (N-Term) (ABIN630196)

Target: LIG4 (Ligase IV, DNA, ATP-Dependent (LIG4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LIG4 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-LIG4 Antibody

Binding Specificity: N-Term

Specificity: LIG4 antibody was raised against the N terminal of LIG4

Purification: Purified

Immunogen: LIG4 antibody was raised using the N terminal of LIG4 corresponding to a region with amino acids DGERMQMHKDGDVYKYFSRNGYNYTDQFGASPTEGSLTPFIHNAFKADIQ

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LIG4 Blocking Peptide, (ABIN937334), is also available for use as a blocking control in assays to test for specificity of this LIG4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIG4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LIG4

Target: LIG4 (Ligase IV, DNA, ATP-Dependent (LIG4))

Alternative Name: LIG4

Background: LIG4 encodes a DNA ligase that joins single-strand breaks in a double-stranded polydeoxynucleotide in an ATP-dependent reaction. This protein is essential for V(D)J recombination and DNA double-strand break (DSB) repair through nonhomologous end joining (NHEJ). This protein forms a complex with the X-ray repair cross complementing protein 4 (XRCC4), and further interacts with the DNA-dependent protein kinase (DNA-PK). Both XRCC4 and DNA-PK are known to be required for NHEJ. The crystal structure of the complex formed by this protein and XRCC4 has been resolved. Defects in this gene are the cause of LIG4 syndrome.

Molecular Weight: 104 kDa (MW of target protein)

Pathways: DNA Damage Repair, Production of Molecular Mediator of Immune Response