KIFC2 antibody (N-Term)

Catalog No. ABIN630204

This anti-KIFC2 antibody is a Rabbit Polyclonal antibody detecting KIFC2 in WB and IHC. Suitable for Human.

Quick Overview for KIFC2 antibody (N-Term) (ABIN630204)

Target: KIFC2 (Kinesin Family Member C2 (KIFC2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KIFC2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-KIFC2 Antibody

Binding Specificity: N-Term

Specificity: KIFC2 antibody was raised against the N terminal of KIFC2

Purification: Purified

Immunogen: KIFC2 antibody was raised using the N terminal of KIFC2 corresponding to a region with amino acids VRPPSPDGSTSQEESPSHFTAVPGEPLGDETQGQQPLQLEEDQRAWQRLE

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KIFC2 Blocking Peptide, (ABIN5614360), is also available for use as a blocking control in assays to test for specificity of this KIFC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIFC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KIFC2

Target: KIFC2 (Kinesin Family Member C2 (KIFC2))

Alternative Name: KIFC2

Background: Members of the kinesin superfamily of microtubule-associated proteins are involved in a variety of intracellular processes including cell division and organelle transport. KIFC2 encodes a 792 amino acid protein, which contains the conserved motor domain at the C-terminal end of the protein and is most similar to members of the KAR3 family involved in cell division.

Molecular Weight: 90 kDa (MW of target protein)