HDAC9 antibody (C-Term)
-
- Target See all HDAC9 Antibodies
- HDAC9 (Histone Deacetylase 9 (HDAC9))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HDAC9 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- HDAC9 antibody was raised against the C terminal of HDAC9
- Purification
- Purified
- Immunogen
- HDAC9 antibody was raised using the C terminal of HDAC9 corresponding to a region with amino acids QVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQVIGKDLAPGFVIKVII
- Top Product
- Discover our top product HDAC9 Primary Antibody
-
anti-Histone Deacetylase 9 (HDAC9) (AA 2-32), (N-Term) antibody
HDAC9 Reactivity: Human WB, IF, IP, IHC (p) Host: Rabbit Polyclonal RB2582 unconjugated
anti-Histone Deacetylase 9 (HDAC9) (AA 1-100) antibodyHDAC9 Reactivity: Human WB, IHC Host: Rabbit Polyclonal unconjugated
anti-Histone Deacetylase 9 (HDAC9) (C-Term) antibodyHDAC9 Reactivity: Human, Mouse, Guinea Pig, Sheep WB, IHC, ChIP Host: Rabbit Polyclonal unconjugated
anti-Histone Deacetylase 9 (HDAC9) (AA 2-32) antibodyHDAC9 Reactivity: Human WB, IHC, ELISA, IF, IP Host: Rabbit Polyclonal unconjugated
anti-Histone Deacetylase 9 (HDAC9) antibodyHDAC9 Reactivity: Human WB, IHC, ELISA, IF Host: Rabbit Monoclonal 1F2 unconjugated Recombinant Antibody
anti-Histone Deacetylase 9 (HDAC9) (AA 343-569) antibodyHDAC9 Reactivity: Human ELISA, FACS Host: Mouse Monoclonal 2B7C4 unconjugated
anti-Histone Deacetylase 9 (HDAC9) (AA 23-343) antibodyHDAC9 Reactivity: Human WB, IHC, IP, ICC Host: Rabbit Polyclonal unconjugated
anti-Histone Deacetylase 9 (HDAC9) (AA 503-533), (C-Term) antibodyHDAC9 Reactivity: Human WB, IHC (p) Host: Rabbit Polyclonal RB2742 unconjugated
anti-Histone Deacetylase 9 (HDAC9) (pSer220), (pSer259) antibodyHDAC9 Reactivity: Human WB, IHC, ELISA Host: Rabbit Polyclonal unconjugated
anti-Histone Deacetylase 9 (HDAC9) (C-Term) antibodyHDAC9 Reactivity: Human WB, IHC, ELISA, IF Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HDAC9 Blocking Peptide, catalog no. 33R-7773, is also available for use as a blocking control in assays to test for specificity of this HDAC9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HDAC9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HDAC9 (Histone Deacetylase 9 (HDAC9))
- Alternative Name
- HDAC9 (HDAC9 Products)
- Background
- Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. HDAC9 has sequence homology to members of the histone deacetylase family. The MITR protein lacks the histone deacetylase catalytic domain. It represses MEF2 activity through recruitment of multicomponent corepressor complexes that include CtBP and HDACs. HDAC9 may play a role in hematopoiesis.
- Molecular Weight
- 65 kDa (MW of target protein)
- Pathways
- Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development
-
