GNAS antibody (N-Term)

Catalog No. ABIN630225

Product Details anti-GNAS Antibody

Target: GNAS (GNAS Complex Locus (GNAS))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GNAS antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: GNAS antibody was raised against the N terminal of GNAS

Purification: Purified

Immunogen: GNAS antibody was raised using the N terminal of GNAS corresponding to a region with amino acids SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GNAS Blocking Peptide, catalog no. 33R-8471, is also available for use as a blocking control in assays to test for specificity of this GNAS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNAS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GNAS

Target: GNAS (GNAS Complex Locus (GNAS))

Alternative Name: GNAS (GNAS Products)

Synonyms: AHO antibody, C20orf45 antibody, GNAS1 antibody, GPSA antibody, GSA antibody, GSP antibody, NESP antibody, PHP1A antibody, PHP1B antibody, PHP1C antibody, POH antibody, GNAS antibody, PORGSA1 antibody, G-alpha-S antibody, 5530400H20Rik antibody, A930027G11Rik antibody, C130027O20Rik antibody, Galphas antibody, Gnas1 antibody, Gnasxl antibody, Gsa antibody, Nesp antibody, Nespl antibody, Oed-Sml antibody, Oedsml antibody, P1 antibody, P2 antibody, P3 antibody, G-alpha-s antibody, gnas-a antibody, Gnpas antibody, Nesp55 antibody, gnal antibody, Gnas antibody, GNAS complex locus antibody, guanine nucleotide-binding protein G(s) subunit alpha antibody, GNAS (guanine nucleotide binding protein, alpha stimulating) complex locus antibody, GNAS complex locus S homeolog antibody, neuroendocrine secretory protein 55-like antibody, GNAS antibody, LOC694289 antibody, LOC469986 antibody, Gnas antibody, gnas.S antibody, gnas antibody, LOC100346323 antibody, LOC100442753 antibody, LOC100732436 antibody

Background: Mutations in GNAS gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors.

Molecular Weight: 42 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis, cAMP Metabolic Process, Myometrial Relaxation and Contraction, Embryonic Body Morphogenesis