G3BP1 antibody (N-Term)
-
- Target See all G3BP1 Antibodies
- G3BP1 (GTPase Activating Protein (SH3 Domain) Binding Protein 1 (G3BP1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This G3BP1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- G3 BP antibody was raised against the N terminal Of G3 p
- Purification
- Purified
- Immunogen
- G3 BP antibody was raised using the N terminal Of G3 p corresponding to a region with amino acids EVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEE
- Top Product
- Discover our top product G3BP1 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
G3BP Blocking Peptide, catalog no. 33R-2785, is also available for use as a blocking control in assays to test for specificity of this G3BP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of G0 P antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- G3BP1 (GTPase Activating Protein (SH3 Domain) Binding Protein 1 (G3BP1))
- Alternative Name
- G3BP (G3BP1 Products)
- Background
- G3BP is one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear RNA-binding proteins and is also an element of the Ras signal transduction pathway. It binds specifically to the Ras-GTPase-activating protein by associating with its SH3 domain. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
- Molecular Weight
- 51 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-