Complement C2 antibody (Middle Region)

Catalog No. ABIN630230

The Rabbit Polyclonal anti-Complement C2 antibody has been validated for WB. It is suitable to detect Complement C2 in samples from Human, Rat, Mouse, Dog and Zebrafish (Danio rerio).

Quick Overview for Complement C2 antibody (Middle Region) (ABIN630230)

Target: Complement C2

Reactivity: Human, Rat, Mouse, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Complement C2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Complement C2 Antibody

Binding Specificity: Middle Region

Specificity: Complement C2 antibody was raised against the middle region of C2

Purification: Purified

Immunogen: Complement C2 antibody was raised using the middle region of C2 corresponding to a region with amino acids INQKRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQ

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Complement C2 Blocking Peptide, (ABIN939465), is also available for use as a blocking control in assays to test for specificity of this Complement C2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Complement C2

Target: Complement C2

Background: Component C2 is part of the classical pathway of complement system. Activated C1 cleaves C2 into C2a and C2b. C2a leads to activation of C3. Deficiency of C2 has been reported to associated with certain autoimmune diseases.

Molecular Weight: 83 kDa (MW of target protein)