IGSF1 antibody (N-Term)

Catalog No. ABIN630244

This Rabbit Polyclonal antibody specifically detects IGSF1 in WB and IHC. It exhibits reactivity toward Human.

Quick Overview for IGSF1 antibody (N-Term) (ABIN630244)

Target: IGSF1 (INHBP) (Inhibin Binding Protein (INHBP))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IGSF1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-IGSF1 Antibody

Binding Specificity: N-Term

Specificity: IGSF1 antibody was raised against the N terminal of IGSF1

Purification: Purified

Immunogen: IGSF1 antibody was raised using the N terminal of IGSF1 corresponding to a region with amino acids LCHGWLQDLVFMLFKEGYAEPVDYQVPTGTMAIFSIDNLTPEDEGVYICR

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IGSF1 Blocking Peptide, (ABIN940207), is also available for use as a blocking control in assays to test for specificity of this IGSF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGSF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IGSF1

Target: IGSF1 (INHBP) (Inhibin Binding Protein (INHBP))

Alternative Name: IGSF1

Background: Members of the immunoglobulin (Ig) superfamily, which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior.Members of the immunoglobulin (Ig) superfamily, which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior.

Molecular Weight: 27 kDa (MW of target protein)