Annexin A2 antibody (C-Term)

Catalog No. ABIN630252

Product Details anti-Annexin A2 Antibody

Target: Annexin A2 (ANXA2)

Binding Specificity: C-Term

Reactivity: Chemical

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Annexin A2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Annexin A2 antibody was raised against the C terminal of ANXA2

Cross-Reactivity: Human, Mouse (Murine), Dog (Canine)

Purification: Purified

Immunogen: Annexin A2 antibody was raised using the C terminal of ANXA2 corresponding to a region with amino acids RIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Annexin A2 Blocking Peptide, catalog no. 33R-7972, is also available for use as a blocking control in assays to test for specificity of this Annexin A2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Annexin A2

Target: Annexin A2 (ANXA2)

Alternative Name: Annexin A2 (ANXA2 Products)

Target Type: Chemical

Background: ANXA2 encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions as an autocrine factor which heightens osteoclast formation and bone resorption. ANXA2 has three pseudogenes located on chromosomes 4, 9 and 10, respectively. Multiple alternatively spliced transcript variants encoding different isoforms have been found for ANXA2.

Molecular Weight: 37 kDa (MW of target protein)

Pathways: S100 Proteins